Structure of PDB 4iim Chain B Binding Site BS01

Receptor Information
>4iim Chain B (length=55) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKS
YVKLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4iim Crystal structure of the Second SH3 Domain of ITSN1 bound with a synthetic peptide
Resolution1.8 Å
Binding residue
(original residue number in PDB)		K928 N930 H931 L943 E944 M948 W949 F951 K958 W960
Binding residue
(residue number reindexed from 1)		K14 N16 H17 L29 E30 M34 W35 F37 K44 W46
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4iim, PDBe:4iim, PDBj:4iim
PDBsum4iim
PubMed
UniProtQ15811|ITSN1_HUMAN Intersectin-1 (Gene Name=ITSN1)

[Back to BioLiP]