Structure of PDB 4iht Chain B Binding Site BS01

Receptor Information

>4iht Chain B (length=90) Species: 62977 (Acinetobacter baylyi ADP1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLER
GSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASGHH

Ligand information

>4iht Chain E (length=25) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

taaaaatactccataggtattttat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4iht The DNA-binding domain of BenM reveals the structural basis for the recognition of a T-N11-A sequence motif by LysR-type transcriptional regulators.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	S17 F18 T19 Q29 P30 S33 Q37
Binding residue (residue number reindexed from 1)	S17 F18 T19 Q29 P30 S33 Q37

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4iht, PDBe:4iht, PDBj:4iht
PDBsum	4iht
PubMed	24100318
UniProt	O68014\|BENM_ACIAD HTH-type transcriptional regulator BenM (Gene Name=benM)

[Back to BioLiP]