Structure of PDB 4idw Chain B Binding Site BS01

Receptor Information

>4idw Chain B (length=30) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Ligand information

>4idw Chain A (length=21) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GIVEQCCASVCSLYQLENYCN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4idw High-resolution powder X-ray data reveal the T6 hexameric form of bovine insulin
Resolution	N/A
Binding residue (original residue number in PDB)	F1 N3 Q4 H5 L6 C7 V18 C19 R22 G23 F25 Y26 T27 K29
Binding residue (residue number reindexed from 1)	F1 N3 Q4 H5 L6 C7 V18 C19 R22 G23 F25 Y26 T27 K29

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005179	hormone activity

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:4idw, PDBe:4idw, PDBj:4idw
PDBsum	4idw
PubMed	23695242
UniProt	P01317\|INS_BOVIN Insulin (Gene Name=INS)

[Back to BioLiP]