Structure of PDB 4i6z Chain B Binding Site BS01

Receptor Information

>4i6z Chain B (length=200) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEEL
YYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEA
DFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIA
LKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK

Ligand information

>4i6z Chain C (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gactgactgaca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4i6z Crystal structure of the transcriptional regulator TM1030 with 24bp DNA oligonucleotide
Resolution	3.2 Å
Binding residue (original residue number in PDB)	K4 A36 G38 L39 H42 Y43
Binding residue (residue number reindexed from 1)	K4 A36 G38 L39 H42 Y43

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4i6z, PDBe:4i6z, PDBj:4i6z
PDBsum	4i6z
PubMed
UniProt	Q9X0C0

[Back to BioLiP]