Structure of PDB 4i5z Chain B Binding Site BS01

Receptor Information
>4i5z Chain B (length=30) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4i5z A review of the strategies for obtaining high-quality crystals utilizing nanotechnologies and microgravity
Resolution1.8 Å
Binding residue
(original residue number in PDB)		V2 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 P28
Binding residue
(residue number reindexed from 1)		V2 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 P28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4i5z, PDBe:4i5z, PDBj:4i5z
PDBsum4i5z
PubMed25403962
UniProtP01317|INS_BOVIN Insulin (Gene Name=INS)

[Back to BioLiP]