Structure of PDB 4i51 Chain B Binding Site BS01

Receptor Information
>4i51 Chain B (length=258) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNID
RNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIF
ECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVC
EYVGELISDSEADVREEDSYLFDLDVYCIDARFYGNVSRFINHHCEPNLV
PVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDAGERFWDIKGKLFSCRC
GSPKCRHS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4i51 Defining efficient enzyme-cofactor pairs for bioorthogonal profiling of protein methylation.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		D1131 A1134 D1135 D1140 S1141 L1143 F1144 D1145 A1211 R1214 F1215 I1218
Binding residue
(residue number reindexed from 1)		D159 A162 D163 D168 S169 L171 F172 D173 A234 R237 F238 I241
Enzymatic activity
Catalytic site (original residue number in PDB) A1211
Catalytic site (residue number reindexed from 1) A234
Enzyme Commision number 2.1.1.-
2.1.1.367: [histone H3]-lysine(9) N-methyltransferase.
Gene Ontology
Molecular Function
GO:0002039 p53 binding
GO:0008270 zinc ion binding
GO:0016279 protein-lysine N-methyltransferase activity
GO:0042054 histone methyltransferase activity
GO:0046974 histone H3K9 methyltransferase activity
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4i51, PDBe:4i51, PDBj:4i51
PDBsum4i51
PubMed24082136
UniProtQ9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 (Gene Name=EHMT1)

[Back to BioLiP]