Structure of PDB 4i2o Chain B Binding Site BS01

Receptor Information

>4i2o Chain B (length=198) Species: 375 (Bradyrhizobium japonicum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LVATEFSYRKDEEIYGEDEPAEYVYQVVTGAVRSYKLLSDGRRQIGAFHL
PGDVFGLESGPSHRLAAEAIIDTSVRLVKRSSLEKAAGIDVQVARKLWAM
TAGELRHAEDHMLLLGRKTAMERVATFLLEMDRRLAVAGMMALPMSRRDI
GDYLGLTLETVSRALSQLHTQGILGFSGARQIVLRNRQRLHNLDAAAA

Ligand information

>4i2o Chain W (length=25) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gggaattgattgaaatcaagatagg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4i2o The Structure of Bradyrhizobium japonicum Transcription Factor FixK2 Unveils Sites of DNA Binding and Oxidation.
Resolution	1.77 Å
Binding residue (original residue number in PDB)	T156 A157 T194 E196 T197
Binding residue (residue number reindexed from 1)	T119 A120 T157 E159 T160

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4i2o, PDBe:4i2o, PDBj:4i2o
PDBsum	4i2o
PubMed	23546876
UniProt	O69245

[Back to BioLiP]