Structure of PDB 4hy9 Chain B Binding Site BS01

Receptor Information
>4hy9 Chain B (length=215) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTI
HVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSA
KDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQ
GDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKM
QELAQVSQKLMEIAQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hy9 Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		I401 E402 T403 M404 F426 S427 T428 A429 Q433 A435 V436 T437 I438 G468 H541
Binding residue
(residue number reindexed from 1)		I13 E14 T15 M16 F38 S39 T40 A41 Q45 A47 V48 T49 I50 G80 H153
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0140662 ATP-dependent protein folding chaperone

View graph for
Molecular Function
External links
PDB RCSB:4hy9, PDBe:4hy9, PDBj:4hy9
PDBsum4hy9
PubMed23562829
UniProtP0A6Y8|DNAK_ECOLI Chaperone protein DnaK (Gene Name=dnaK)

[Back to BioLiP]