Structure of PDB 4hri Chain B Binding Site BS01

Receptor Information
>4hri Chain B (length=280) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NDIDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYM
TYLEQGQNLRMTGHLHHLEPKRVKIIVEEVRQALMEGKLLKTLGSQEPRY
LIQFPYVWMEQYPWIPPGTSLTSEEKRQIEHKLPSNLPDAQLVTSFEFLE
LIEFLHKRSQEDLPPEHRMELSEALAEHIKRRLLYSGTVTRIDSPWGMPF
YALTRPERTYIMVEDTARYFRMMKDWAEKRPNAMRALEELDVPPERWDEA
MQELDEIIRTWADKYHQVIPMILQMVFGRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hri Structural and biochemical analyses of Anabaena HetR reveal insights into its binding to DNA targets and the inhibitory hexapeptide ERGSGR
Resolution2.954 Å
Binding residue
(original residue number in PDB)		G36 N60 L61 R62 K73 K76 S179 E180 A181
Binding residue
(residue number reindexed from 1)		G34 N58 L59 R60 K71 K74 S172 E173 A174
Enzymatic activity
Enzyme Commision number 3.4.21.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
GO:0042802 identical protein binding
Biological Process
GO:0006508 proteolysis
GO:0043158 heterocyst development

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4hri, PDBe:4hri, PDBj:4hri
PDBsum4hri
PubMed
UniProtP27709|HETR_NOSS1 DNA-binding transcriptional activator HetR (Gene Name=hetR)

[Back to BioLiP]