Structure of PDB 4hqr Chain B Binding Site BS01

Receptor Information
>4hqr Chain B (length=230) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGF
DVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGV
TPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQPVEADFLFAY
STVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHF
ESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hqr Structural asymmetry of procaspase-7 bound to a specific inhibitor
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R87 C186 S231 W232 R233 S234 P235 Q276
Binding residue
(residue number reindexed from 1)		R31 C130 S158 W159 R160 S161 P162 Q203
Enzymatic activity
Catalytic site (original residue number in PDB) G85 V86 H144 G145 C186
Catalytic site (residue number reindexed from 1) G29 V30 H88 G89 C130
Enzyme Commision number 3.4.22.60: caspase-7.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4hqr, PDBe:4hqr, PDBj:4hqr
PDBsum4hqr
PubMed23897474
UniProtP55210|CASP7_HUMAN Caspase-7 (Gene Name=CASP7)

[Back to BioLiP]