Structure of PDB 4hha Chain B Binding Site BS01

Receptor Information
>4hha Chain B (length=226) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGGGVVQPGRSLRLSCAASGFTFSNHGMHWVRQAPGKRLEWVAV
ISYDGRHEHYADLVKGRFTISRDNSKNTLYLQMNSLRAEDRALYFCAREG
LSRDNSGFTGLIDYWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
GCLVKDYFPEPVTVSWNSGALSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKKVEPKS
Ligand information
>4hha Chain P (length=10) Species: 10359 (Human betaherpesvirus 5) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ETIYNTTLKY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hha Structures of Preferred Human IgV Genes-Based Protective Antibodies Identify How Conserved Residues Contact Diverse Antigens and Assign Source of Specificity to CDR3 Loop Variation.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		H32 Y52A H56 G96 L97 S98 R99 N100A S100B G100C F100D T100E L100G
Binding residue
(residue number reindexed from 1)		H32 Y53 H57 G100 L101 S102 R103 N105 S106 G107 F108 T109 L111
External links