Structure of PDB 4han Chain B Binding Site BS01

Receptor Information

>4han Chain B (length=293) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSMMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQV
DLQNGSSVKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFK
REKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHS
IGFSFSSHMRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSK
DIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCD
VREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW

Ligand information

>4han Chain D (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PGLAYGNPY

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4han Structural basis for recognition of autophagic receptor NDP52 by the sugar receptor galectin-8.
Resolution	2.551 Å
Binding residue (original residue number in PDB)	K204 E268 I270 K279 V280 A281 N283 G284 H286 R315
Binding residue (residue number reindexed from 1)	K180 E244 I246 K255 V256 A257 N259 G260 H262 R291

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0030246	carbohydrate binding

View graph for
Molecular Function

External links

PDB	RCSB:4han, PDBe:4han, PDBj:4han
PDBsum	4han
PubMed	23511477
UniProt	O00214\|LEG8_HUMAN Galectin-8 (Gene Name=LGALS8)

[Back to BioLiP]