Structure of PDB 4h5q Chain B Binding Site BS01

Receptor Information
>4h5q Chain B (length=243) Species: 11588 (Rift Valley fever virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NYQELAIQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEK
DAKKMIVLALTRGNKPRRMMMKMSKEGKATVEALINKYKLKEGNPSRDEL
TLSRVAAALAGRTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGM
VDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPMNA
AVNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4h5q Phleboviruses encapsidate their genomes by sequestering RNA bases.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y30 A61 T63 G65 N66 K67 R70 G95 N96 S105 P127 F176 I180 Q198 P199
Binding residue
(residue number reindexed from 1)		Y28 A59 T61 G63 N64 K65 R68 G93 N94 S103 P125 F174 I178 Q196 P197
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0042802 identical protein binding
Cellular Component
GO:0019013 viral nucleocapsid
GO:0019028 viral capsid
GO:0030430 host cell cytoplasm
GO:0042025 host cell nucleus
GO:0044172 host cell endoplasmic reticulum-Golgi intermediate compartment
GO:0044177 host cell Golgi apparatus
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4h5q, PDBe:4h5q, PDBj:4h5q
PDBsum4h5q
PubMed23129612
UniProtD3K5I7|NCAP_RVFV Nucleoprotein (Gene Name=N)

[Back to BioLiP]