Structure of PDB 4gzf Chain B Binding Site BS01

Receptor Information
>4gzf Chain B (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQITLWKRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGI
GGFVKVRQYDQVPIEICGHKVIGTVLVGPTPTNVIGRNLMTQIGCTLNF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gzf Ligand modifications to reduce the relative resistance of multi-drug resistant HIV-1 protease.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		N25 G27 A28 D29 G48 G49 P81 T82
Binding residue
(residue number reindexed from 1)		N25 G27 A28 D29 G48 G49 P81 T82
Enzymatic activity
Catalytic site (original residue number in PDB) N25 T26 G27
Catalytic site (residue number reindexed from 1) N25 T26 G27
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004190 aspartic-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4gzf, PDBe:4gzf, PDBj:4gzf
PDBsum4gzf
PubMed24128815
UniProtQ9QM22

[Back to BioLiP]