Structure of PDB 4guq Chain B Binding Site BS01

Receptor Information

>4guq Chain B (length=198) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EFIPSNTDYPGPHHFEVTFQQSSTAKFATWTYSPLLKKLYCQIAKTCPIQ
IKVTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASH
LIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCV
GGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYRE

Ligand information

>4guq Chain E (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaacatgttc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4guq Transactivation specificity is conserved among p53 family proteins and depends on a response element sequence code.
Resolution	3.7 Å
Binding residue (original residue number in PDB)	S261 R293 A296
Binding residue (residue number reindexed from 1)	S148 R180 A183
Binding affinity	PDBbind-CN: Kd=4480nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006915	apoptotic process

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4guq, PDBe:4guq, PDBj:4guq
PDBsum	4guq
PubMed	23892287
UniProt	O15350\|P73_HUMAN Tumor protein p73 (Gene Name=TP73)

[Back to BioLiP]