Structure of PDB 4gop Chain B Binding Site BS01

Receptor Information
>4gop Chain B (length=122) Species: 237631 () [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTLRPVTIRQILNAEQPHPDAEFILDGAELGQLTFVAVVRNISRNATNVA
YSVEDGTGQIEVRQWLDASEIRNNVYVRVLGTLKSFQNRRSISSGHMRPV
IDYNEVMFHRLEAVHAHLQVTR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gop Structure and conformational change of a replication protein A heterotrimer bound to ssDNA.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Q77 W110 D112 G134 T135 F139 Q140 S146 G148
Binding residue
(residue number reindexed from 1)		Q32 W65 D67 G81 T82 F86 Q87 S93 G95
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Nov 17 17:28:33 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4gop', asym_id = 'B', bs = 'BS01', title = 'Structure and conformational change of a replication protein A heterotrimer bound to ssDNA.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4gop', asym_id='B', bs='BS01', title='Structure and conformational change of a replication protein A heterotrimer bound to ssDNA.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003676', uniprot = '', pdbid = '4gop', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676', uniprot='', pdbid='4gop', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>