Structure of PDB 4ggn Chain B Binding Site BS01

Receptor Information
>4ggn Chain B (length=127) Species: 5851 (Plasmodium knowlesi strain H) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDMFNTKSSNGKLRIEDASHNARKLGLAPSSTDEKKIRDLYGDSLTYEQY
LEYLTMCVHDRDNMEELIKMFSHFDNNSSGFLTKNQMKNILTTWGDALTE
QEANDALNAFSSEDRINYKLFCEDILS
Ligand information
>4ggn Chain E (length=15) Species: 73239 (Plasmodium yoelii yoelii) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SLMRVQAHIRKRMVA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ggn The structure of the D3 domain of Plasmodium falciparum myosin tail interacting protein MTIP in complex with a nanobody.
Resolution2.29 Å
Binding residue
(original residue number in PDB)		H98 R101 G104 L105 A106 S108 D138 D140 E144 L145 L169 W172 G173 D174 A175 L176 D183 A184 F199 D202 I203 L204 S205
Binding residue
(residue number reindexed from 1)		H20 R23 G26 L27 A28 S30 D60 D62 E66 L67 L91 W94 G95 D96 A97 L98 D105 A106 F121 D124 I125 L126 S127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:4ggn, PDBe:4ggn, PDBj:4ggn
PDBsum4ggn
PubMed23831371
UniProtA0A384KCF1

[Back to BioLiP]