Structure of PDB 4gg6 Chain B Binding Site BS01

Receptor Information
>4gg6 Chain B (length=163) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTP
LGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTIS
PSLLVCSVTDFYPAQIKVRWFETTGVVSTPLIRNGDWTFQILVMLETCHV
EHPSLQNPIIVEW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gg6 Biased T cell receptor usage directed against human leukocyte antigen DQ8-restricted gliadin peptides is associated with celiac disease.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
F11 G13 C15 L26 T28 Y30 Y37 Y47 A57 Y60 W61 E74 V78 H81 N82 L85
Binding residue
(residue number reindexed from 1)
F9 G11 C13 L24 T26 Y28 Y35 Y45 A55 Y58 W59 E72 V76 H79 N80 L83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4gg6, PDBe:4gg6, PDBj:4gg6
PDBsum4gg6
PubMed23063329
UniProtP01920|DQB1_HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain (Gene Name=HLA-DQB1)

[Back to BioLiP]