Structure of PDB 4g91 Chain B Binding Site BS01

Receptor Information
>4g91 Chain B (length=91) Species: 227321 (Aspergillus nidulans FGSC A4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEQDRWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEAS
EKCQQEKRKTVNGEDILFAMTSLGFENYAEALKIYLSKYRE
Ligand information
>4g91 Chain A (length=28) Species: 162425 (Aspergillus nidulans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ESPLYVNAKQFHRILKRRVARQKLEEQL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4g91 DNA Minor Groove Sensing and Widening by the CCAAT-Binding Complex.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R46 E81 S84 F85 S88 E89 E92 L114 E117
Binding residue
(residue number reindexed from 1)		R5 E40 S43 F44 S47 E48 E51 L73 E76
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043565 sequence-specific DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0016602 CCAAT-binding factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4g91, PDBe:4g91, PDBj:4g91
PDBsum4g91
PubMed22902862
UniProtQ5B5Z6

[Back to BioLiP]