Structure of PDB 4g83 Chain B Binding Site BS01

Receptor Information

>4g83 Chain B (length=198) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQ
IKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPAS
HLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSC
VGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYR

Ligand information

>4g83 Chain E (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaaccggttc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4g83 Crystal Structure of p73 DNA-Binding Domain Tetramer bound to a Full Response-Element
Resolution	4.0 Å
Binding residue (original residue number in PDB)	S261 R293 C295 A296 R300
Binding residue (residue number reindexed from 1)	S149 R181 C183 A184 R188

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006915	apoptotic process

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4g83, PDBe:4g83, PDBj:4g83
PDBsum	4g83
PubMed
UniProt	O15350\|P73_HUMAN Tumor protein p73 (Gene Name=TP73)

[Back to BioLiP]