Structure of PDB 4g0a Chain B Binding Site BS01

Receptor Information
>4g0a Chain B (length=312) Species: 36435 (Simian 11 rotavirus (serotype 3 / strain SA11-Ramig)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AELACFCYPHLENDSYKFIPFNNLAIKAMLTAKVDKKDMDKFYDSIIYGI
APPPQFKKRYNTNDNSRGMNFETIMFTKVAMLICEALNSLKVTQANVSNV
LSRVVSIRHLENLVIRKENPQDILFHSKDLLLKSTLIAIGQSKEIETTIT
AEGGEIVFQNAAFTMWKLTYLEHQLMPILDQNFIEYKVTLNEDKPISDVH
VKELVAELRWQYNKFAVITHGKGHYRIVKYSSVANHADRVYATFKSNVKT
GVNNDFNLLDQRIIWQNWYAFTSSMKQGNTLDVCKRLLFQKMKPEKNPFK
GLSTDRKMDEVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4g0a Crystallographic Analysis of Rotavirus NSP2-RNA Complex Reveals Specific Recognition of 5' GG Sequence for RTPase Activity.
Resolution2.0995 Å
Binding residue
(original residue number in PDB)		R104 V105 K223 R227 N236 D239 R240
Binding residue
(residue number reindexed from 1)		R103 V104 K222 R226 N235 D238 R239
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003723 RNA binding
GO:0004550 nucleoside diphosphate kinase activity
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0016817 hydrolase activity, acting on acid anhydrides
GO:0017111 ribonucleoside triphosphate phosphatase activity
GO:0046872 metal ion binding
Biological Process
GO:0019079 viral genome replication
Cellular Component
GO:0030430 host cell cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4g0a, PDBe:4g0a, PDBj:4g0a
PDBsum4g0a
PubMed22811529
UniProtQ03243|NSP2_ROTSR Non-structural protein 2

[Back to BioLiP]