Structure of PDB 4fx4 Chain B Binding Site BS01

Receptor Information
>4fx4 Chain B (length=133) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ECACYTTRRAARQLGQAYDRALRPSGLTNTQFSTLAVISLSTMSELAARI
GVERTTLTRNLEVMRRDGLVRVMAGADARCKRIELTAKGRAALQKAVPLW
RGVQAEVTASVGDWPRVRRDIANLGQAAEACRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4fx4 The Oxidation-sensing Regulator (MosR) Is a New Redox-dependent Transcription Factor in Mycobacterium tuberculosis.
Resolution3.1001 Å
Binding residue
(original residue number in PDB)		T38 Q39 V68 E69 T71 T72 N76 R82 D93 A94 R95
Binding residue
(residue number reindexed from 1)		T30 Q31 V52 E53 T55 T56 N60 R66 D77 A78 R79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4fx4, PDBe:4fx4, PDBj:4fx4
PDBsum4fx4
PubMed22992749
UniProtO53397

[Back to BioLiP]