Structure of PDB 4fif Chain B Binding Site BS01

Receptor Information
>4fif Chain B (length=293) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKL
VAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVME
FLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSI
LLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEV
DIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLK
GFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4fif Type II p21-activated kinases (PAKs) are regulated by an autoinhibitory pseudosubstrate.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		S331 R359 T404 D444 F461 L475 V476 G477 Y480 W481 F516
Binding residue
(residue number reindexed from 1)		S35 R63 T108 D148 F165 L179 V180 G181 Y184 W185 F220
Enzymatic activity
Catalytic site (original residue number in PDB) D440 K442 D444 S445 D458 K467 T478
Catalytic site (residue number reindexed from 1) D144 K146 D148 S149 D162 K171 T182
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0005524 ATP binding
Biological Process
GO:0006468 protein phosphorylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4fif, PDBe:4fif, PDBj:4fif
PDBsum4fif
PubMed22988085
UniProtO96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 (Gene Name=PAK4)

[Back to BioLiP]