Structure of PDB 4faf Chain B Binding Site BS01

Receptor Information
>4faf Chain B (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGI
GGFVKVRQYDQVPIEICGHKVIGTVLVGPTPTNVIGRNLMTQIGCTLNF
Ligand information
>4faf Chain D (length=7) Species: 11686 (Human immunodeficiency virus type 1 (BRU ISOLATE)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RVLFEAM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4faf Higher Desolvation Energy Reduces Molecular Recognition in Multi-Drug Resistant HIV-1 Protease.
Resolution2.1 Å
Binding residue
(original residue number in PDB)
R8 N25 G27 A28 D29 D30 I47 G48 I50 T82
Binding residue
(residue number reindexed from 1)
R8 N25 G27 A28 D29 D30 I47 G48 I50 T82
Enzymatic activity
Catalytic site (original residue number in PDB) N25 T26 G27
Catalytic site (residue number reindexed from 1) N25 T26 G27
Enzyme Commision number 3.1.26.13: retroviral ribonuclease H.
Gene Ontology
Molecular Function
GO:0004190 aspartic-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4faf, PDBe:4faf, PDBj:4faf
PDBsum4faf
PubMed24832048
UniProtQ000H7

[Back to BioLiP]