Structure of PDB 4f56 Chain B Binding Site BS01

Receptor Information

>4f56 Chain B (length=272) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SFTARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKW
QAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGK
QGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPI
CPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPA
ILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTP
ATNRFRFHFQGPCGTTLPEALA

Ligand information

>4f56 Chain D (length=7) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TARKSTG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4f56 The Bicyclic Intermediate Structure Provides Insights into the Desuccinylation Mechanism of Human Sirtuin 5 (SIRT5)
Resolution	1.7 Å
Binding residue (original residue number in PDB)	V221 W222 F223 G224 E225 N226 L227 V254 Y255 P256
Binding residue (residue number reindexed from 1)	V191 W192 F193 G194 E195 N196 L197 V224 Y225 P226

Enzymatic activity

Catalytic site (original residue number in PDB)	P68 T69 F70 R71 N141 D143 H158
Catalytic site (residue number reindexed from 1)	P38 T39 F40 R41 N111 D113 H128
Enzyme Commision number	2.3.1.-

Gene Ontology

	Molecular Function
GO:0036054	protein-malonyllysine demalonylase activity
GO:0036055	protein-succinyllysine desuccinylase activity
GO:0070403	NAD+ binding

View graph for
Molecular Function

External links

PDB	RCSB:4f56, PDBe:4f56, PDBj:4f56
PDBsum	4f56
PubMed	22767592
UniProt	Q9NXA8\|SIR5_HUMAN NAD-dependent protein deacylase sirtuin-5, mitochondrial (Gene Name=SIRT5)

[Back to BioLiP]