Structure of PDB 4f4u Chain B Binding Site BS01

Receptor Information

>4f4u Chain B (length=260) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FTARPSSSMADFRKFFAKAKHIVIISGAGVSAGYWRKWQAQDLATPLAFA
HNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNI
DELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEP
GTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHC
DLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGP
CGTTLPEALA

Ligand information

>4f4u Chain D (length=7) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TARKSTG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4f4u The Bicyclic Intermediate Structure Provides Insights into the Desuccinylation Mechanism of Human Sirtuin 5 (SIRT5)
Resolution	2.0 Å
Binding residue (original residue number in PDB)	Q83 Y102 R105 I142 H158 V221 W222 F223 G224 E225 N226 L227 V253 V254 Y255
Binding residue (residue number reindexed from 1)	Q41 Y60 R63 I100 H116 V179 W180 F181 G182 E183 N184 L185 V211 V212 Y213

Enzymatic activity

Catalytic site (original residue number in PDB)	N141 D143 H158
Catalytic site (residue number reindexed from 1)	N99 D101 H116
Enzyme Commision number	2.3.1.-

Gene Ontology

	Molecular Function
GO:0036054	protein-malonyllysine demalonylase activity
GO:0036055	protein-succinyllysine desuccinylase activity
GO:0070403	NAD+ binding

View graph for
Molecular Function

External links

PDB	RCSB:4f4u, PDBe:4f4u, PDBj:4f4u
PDBsum	4f4u
PubMed	22767592
UniProt	Q9NXA8\|SIR5_HUMAN NAD-dependent protein deacylase sirtuin-5, mitochondrial (Gene Name=SIRT5)

[Back to BioLiP]