Structure of PDB 4eoy Chain B Binding Site BS01

Receptor Information
>4eoy Chain B (length=123) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPSLKDEVSFENRVAETHKIRSKYPNRIPVVIERANRSNLPIIEKKKFLV
PMNMLVGEFKFILHQHINQSAYGSNMKLFRERTIYLFVNNIVPKTGLLMQ
DLYEMYKDEDGYLYMEYSSESSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4eoy Structural characterization and inhibition of the Plasmodium Atg8-Atg3 interaction.
Resolution2.22 Å
Binding residue
(original residue number in PDB)		K48 F49 L50 P52 E59 I63 H67
Binding residue
(residue number reindexed from 1)		K47 F48 L49 P51 E58 I62 H66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008429 phosphatidylethanolamine binding
GO:0046872 metal ion binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0097352 autophagosome maturation
Cellular Component
GO:0000421 autophagosome membrane
GO:0005829 cytosol
GO:0016020 membrane
GO:0020011 apicoplast
GO:0031410 cytoplasmic vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4eoy, PDBe:4eoy, PDBj:4eoy
PDBsum4eoy
PubMed22982544
UniProtQ8IJK2

[Back to BioLiP]