Structure of PDB 4eot Chain B Binding Site BS01

Receptor Information

>4eot Chain B (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRV
QQRHILESEKCQLQSQVEQLKLEVGRLAKERDLYKEKYEKLA

Ligand information

>4eot Chain C (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ccggtgctgagtcagcagg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4eot A Novel DNA Binding Mechanism for maf Basic Region-Leucine Zipper Factors Inferred from a MafA-DNA Complex Structure and Binding Specificities.
Resolution	2.855 Å
Binding residue (original residue number in PDB)	T261 R265 R272
Binding residue (residue number reindexed from 1)	T35 R39 R46
Binding affinity	PDBbind-CN: Kd=0.46nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4eot, PDBe:4eot, PDBj:4eot
PDBsum	4eot
PubMed	23148532
UniProt	Q8NHW3\|MAFA_HUMAN Transcription factor MafA (Gene Name=MAFA)

[Back to BioLiP]