Structure of PDB 4emz Chain B Binding Site BS01

Receptor Information
>4emz Chain B (length=138) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WSKSSVIGWPAVRERMRRAEAQEEEEVGFPVTPQVPLRPMTYKAAVDLSH
FLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPGPGVRYPLTF
GWCYKLVPVEPREVLEWRFDSRLAFHHVARELHPEYFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4emz Structural basis of evasion of cellular adaptive immunity by HIV-1 Nef.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		Q73 V74 P75 M79 T138 F203
Binding residue
(residue number reindexed from 1)		Q34 V35 P36 M40 T99 F137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0017124 SH3 domain binding
GO:0019901 protein kinase binding
GO:0031996 thioesterase binding
GO:0042288 MHC class I protein binding
GO:0042609 CD4 receptor binding
GO:0051117 ATPase binding
Biological Process
GO:0006915 apoptotic process
GO:0019049 virus-mediated perturbation of host defense response
GO:0019058 viral life cycle
GO:0033668 symbiont-mediated suppression of host apoptosis
GO:0039505 symbiont-mediated suppression of host antigen processing and presentation of peptide antigen via MHC class II
GO:0039521 suppression by virus of host autophagy
GO:0045225 negative regulation of CD4 production
GO:0046776 symbiont-mediated suppression of host antigen processing and presentation of peptide antigen via MHC class I
GO:0050848 regulation of calcium-mediated signaling
GO:0070206 protein trimerization
GO:0075528 perturbation by virus of host immune response
Cellular Component
GO:0005576 extracellular region
GO:0016020 membrane
GO:0020002 host cell plasma membrane
GO:0044177 host cell Golgi apparatus
GO:0044178 host cell Golgi membrane
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4emz, PDBe:4emz, PDBj:4emz
PDBsum4emz
PubMed22705789
UniProtQ90VU7

[Back to BioLiP]