Structure of PDB 4eje Chain B Binding Site BS01

Receptor Information
>4eje Chain B (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSREL
MNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKH
VDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSR
Ligand information
>4eje Chain D (length=9) Species: 128952 (Ebola virus - Mayinga, Zaire, 1976) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ILPTAPPEY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4eje To be published
Resolution2.2 Å
Binding residue
(original residue number in PDB)		D34 Y68 N69 M95 P139 F142 S143
Binding residue
(residue number reindexed from 1)		D32 Y66 N67 M93 P137 F140 S141
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015031 protein transport
GO:0036211 protein modification process

View graph for
Biological Process
External links
PDB RCSB:4eje, PDBe:4eje, PDBj:4eje
PDBsum4eje
PubMed
UniProtQ99816|TS101_HUMAN Tumor susceptibility gene 101 protein (Gene Name=TSG101)

[Back to BioLiP]