Structure of PDB 4ed5 Chain B Binding Site BS01

Receptor Information
>4ed5 Chain B (length=169) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVN
YVTAKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTM
TQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSF
NGHKPPGSSEPITVKFAAN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ed5 The structure of the ARE-binding domains of Hu antigen R (HuR) undergoes conformational changes during RNA binding.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		I23 N25 Y26 K50 I52 S60 L61 Y63 F65 K89 T90 K92 A96 R97 S99 I103 K104 Y109 I133 R136 R147 F151 R153 A185
Binding residue
(residue number reindexed from 1)		I6 N8 Y9 K33 I35 S43 L44 Y46 F48 K72 T73 K75 A79 R80 S82 I86 K87 Y92 I116 R119 R130 F134 R136 A168
Binding affinityPDBbind-CN: Kd=169nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Cellular Component
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4ed5, PDBe:4ed5, PDBj:4ed5
PDBsum4ed5
PubMed23519412
UniProtQ15717|ELAV1_HUMAN ELAV-like protein 1 (Gene Name=ELAVL1)

[Back to BioLiP]