Structure of PDB 4duq Chain B Binding Site BS01

Receptor Information

>4duq Chain B (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SSSLEQALAVLVTTFHKYSSQEGDKFKLSKGEMKELLHKELPSFVGEKVD
EEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMSNDFFQ

Ligand information

InChI=1S/Ca/q+2

BHPQYMZQTOCNFJ-UHFFFAOYSA-N

SMILES

Software	SMILES
CACTVS 3.341	[Ca++]
ACDLabs 10.04 OpenEye OEToolkits 1.5.0	[Ca+2]

Formula

Ca

Name

CALCIUM ION

PDB chain

4duq Chain B Residue 103 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4duq The structure of Ca2+-loaded S100A2 at 1.3- angstrom resolution.
Resolution	1.3 Å
Binding residue (original residue number in PDB)	S20 E23 D25 K28 E33
Binding residue (residue number reindexed from 1)	S19 E22 D24 K27 E32
Annotation score	4

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0042802	identical protein binding
GO:0046872	metal ion binding
GO:0046914	transition metal ion binding
GO:0048306	calcium-dependent protein binding

	Biological Process
GO:0043542	endothelial cell migration

	Cellular Component
GO:0005575	cellular_component

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4duq, PDBe:4duq, PDBj:4duq
PDBsum	4duq
PubMed	22394450
UniProt	P29034\|S10A2_HUMAN Protein S100-A2 (Gene Name=S100A2)

[Back to BioLiP]