Structure of PDB 4dm6 Chain B Binding Site BS01

Receptor Information
>4dm6 Chain B (length=239) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDK
FSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRY
TPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETG
LLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKI
LMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLEN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4dm6 Structural basis for a molecular allosteric control mechanism of cofactor binding to nuclear receptors.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		K1246 I1260 P1410 L1411 Q1413 E1414
Binding residue
(residue number reindexed from 1)		K67 I81 P231 L232 Q234 E235
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0048384 retinoic acid receptor signaling pathway
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4dm6, PDBe:4dm6, PDBj:4dm6
PDBsum4dm6
PubMed22355136
UniProtP10826|RARB_HUMAN Retinoic acid receptor beta (Gene Name=RARB)

[Back to BioLiP]