Structure of PDB 4day Chain B Binding Site BS01

Receptor Information
>4day Chain B (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGVRLPRSPPLKVLAEQLRRDAAVWMQGRVVMADRGEARLRDPSGDFSVR
GLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESM
WELEVEDLHRNIP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4day Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		V15 R16 L17 P18 V120 K121
Binding residue
(residue number reindexed from 1)		V3 R4 L5 P6 V86 K87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0006260 DNA replication
GO:0006281 DNA repair
GO:0033045 regulation of sister chromatid segregation
GO:0043007 maintenance of rDNA
GO:0071139 resolution of DNA recombination intermediates
GO:2000042 negative regulation of double-strand break repair via homologous recombination
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005829 cytosol
GO:0016607 nuclear speck
GO:0031422 RecQ family helicase-topoisomerase III complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4day, PDBe:4day, PDBj:4day
PDBsum4day
PubMed22392978
UniProtQ96E14|RMI2_HUMAN RecQ-mediated genome instability protein 2 (Gene Name=RMI2)

[Back to BioLiP]