Structure of PDB 4cyc Chain B Binding Site BS01

Receptor Information
>4cyc Chain B (length=58) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNK
RIRYKKNI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cyc A Flexible Extension of the Drosophila Ultrabithorax Homeodomain Defines a Novel Hox/Pbc Interaction Mode.
Resolution2.36 Å
Binding residue
(original residue number in PDB)		Y25 K31 R53 I54 K57
Binding residue
(residue number reindexed from 1)		Y23 K29 R51 I52 K55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4cyc, PDBe:4cyc, PDBj:4cyc
PDBsum4cyc
PubMed25651060
UniProtP40427|EXD_DROME Homeobox protein extradenticle (Gene Name=exd)

[Back to BioLiP]