Structure of PDB 4cse Chain B Binding Site BS01

Receptor Information
>4cse Chain B (length=112) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QPKPGFCVKTNSSEGKVFINICHSPSIPPPADGFRIPMSLGEPHAELDAK
GQGCTAYDVAVNSNFYLRMQNSDFLRELVVTIAREGLEDKYGLQLNPEWR
MLKYRSFLGSIS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cse Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
K57 K64 A112 K113 R163 L165 K166 Y167
Binding residue
(residue number reindexed from 1)
K9 K16 A49 K50 R100 L102 K103 Y104
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4cse, PDBe:4cse, PDBj:4cse
PDBsum4cse
PubMed24794838
UniProtQ9CQJ2|PIHD1_MOUSE PIH1 domain-containing protein 1 (Gene Name=Pih1d1)

[Back to BioLiP]