Structure of PDB 4ckt Chain B Binding Site BS01

Receptor Information
>4ckt Chain B (length=132) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IQPKPGFCVKTNSSEGKVFINICHSPSIPPPADVTEDELLQMLEEDQAGF
RIPMSLGEPHAELDAKGQGCTAYDVAVNSNFYLRMQNSDFLRELVVTIAR
EGLEDKYGLQLNPEWRMLKYRSFLGSISQQNI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ckt Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
K64 K113 K166 Y167 R168
Binding residue
(residue number reindexed from 1)
K17 K66 K119 Y120 R121
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4ckt, PDBe:4ckt, PDBj:4ckt
PDBsum4ckt
PubMed24794838
UniProtQ9CQJ2|PIHD1_MOUSE PIH1 domain-containing protein 1 (Gene Name=Pih1d1)

[Back to BioLiP]