Structure of PDB 4cfq Chain B Binding Site BS01

Receptor Information
>4cfq Chain B (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRT
DEAAFQKLMSNLDSNRDNEVDFQEYCVFLSSIAM
Ligand information
>4cfq Chain Q (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DATETADAMNREVSSLKNKLRRGDLPF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cfq The C-Terminal Random Coil Region Tunes the Ca2+-Binding Affinity of S100A4 Through Conformational Activation.
Resolution1.37 Å
Binding residue
(original residue number in PDB)		F45 A54 K57 N61 S81
Binding residue
(residue number reindexed from 1)		F45 A54 K57 N61 S81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0046914 transition metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:4cfq, PDBe:4cfq, PDBj:4cfq
PDBsum4cfq
PubMed24830809
UniProtP26447|S10A4_HUMAN Protein S100-A4 (Gene Name=S100A4)

[Back to BioLiP]