Structure of PDB 4cc9 Chain B Binding Site BS01

Receptor Information
>4cc9 Chain B (length=98) Species: 11723 (Simian immunodeficiency virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RERIPPGNSGEETIGEAFDWLDRTVEEINRAAVNHLPRELIFQVWRRSWE
YWHDEMGMSVSYTKYRYLCLIQKAMFMHCKKGCRCLRPGPPPPPPPGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cc9 Structural Basis of Lentiviral Subversion of a Cellular Protein Degradation Pathway.
Resolution2.473 Å
Binding residue
(original residue number in PDB)		G14 E15 E16 T17 I18 F22 W24
Binding residue
(residue number reindexed from 1)		G10 E11 E12 T13 I14 F18 W20
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0019049 virus-mediated perturbation of host defense response
GO:0019058 viral life cycle
GO:0052170 symbiont-mediated suppression of host innate immune response
Cellular Component
GO:0042025 host cell nucleus
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4cc9, PDBe:4cc9, PDBj:4cc9
PDBsum4cc9
PubMed24336198
UniProtP19508|VPX_SIVSP Protein Vpx (Gene Name=vpx)

[Back to BioLiP]