Structure of PDB 4c8z Chain B Binding Site BS01

Receptor Information

>4c8z Chain B (length=231) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MVLAALVLVLEGEGLPEPLGLRGFFYGLLREVAENPFALGFGGREGAAWA
RVSLLVEGLYARLAPRLYALEGEEVRLGPPFRVRAVLQEGHPWAGVSTYP
RLFQGPPSRDLALRFASPTFFRRKGVHYPVPEPRLVLESLLRRLEAFGPL
KAPEGVREALLERTTVRSLEGRTLPARTEVDTAGFVGRVVYHLPRATEEE
ALWLSALGRFAFYSGVGAKTSLGYGRARAES

Ligand information

>4c8z Chain C (length=15) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aagccccguaagggg

...<<<<....>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4c8z Evolution of Crispr RNA Recognition and Processing by Cas6 Endonucleases.
Resolution	2.503 Å
Binding residue (original residue number in PDB)	R174 H199 R202
Binding residue (residue number reindexed from 1)	R167 H192 R195
Binding affinity	PDBbind-CN: Kd=90pM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity
GO:0016788	hydrolase activity, acting on ester bonds

	Biological Process
GO:0051607	defense response to virus

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4c8z, PDBe:4c8z, PDBj:4c8z
PDBsum	4c8z
PubMed	24150936
UniProt	Q5SM65

[Back to BioLiP]