Structure of PDB 4bxw Chain B Binding Site BS01

Receptor Information

>4bxw Chain B (length=287) Species: 8673 (Pseudonaja textilis)

CRVDNGNCWHFCKHIQCSCAEGYLLGEDGHSCVAGGNFSCGRNIKIVNGM
DCKLGECPWQAALVDEKEGVFCGGTILSPIYVLTAAHCINETETISVVVG
EIDKSRIETGPLLSVDKIYVHKKFVPPQKAYKFDLAAYDYDIAIIQMKTP
IQFSENVVPACLPTADFANQVLMKQDFGIVSGFGRIVEKGPKSKTLKVLK
VPYVDRHTCMVSSETPITPNMFCAGYDTLPRDACQGDSGGPHTTVYRDTH
FITGIVSSGEGCARNGKYGNYTKLSKFIPWIKRIMRQ

Ligand information

>4bxw Chain F (length=8) Species: 562 (Escherichia coli)

DIFADIFI

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4bxw Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
• Resolution: 2.71 Å
• Binding residue (original residue number in PDB): N214 K241 I242 Y243 V244 H245 K246 W404
• Binding residue (residue number reindexed from 1): N90 K117 I118 Y119 V120 H121 K122 W280

Enzymatic activity

• Catalytic site (original residue number in PDB): H211 D265 Q359 G360 D361 S362 G363
• Catalytic site (residue number reindexed from 1): H87 D141 Q235 G236 D237 S238 G239
• Enzyme Commision number: 3.4.21.6: coagulation factor Xa.

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding
• GO:0005515 protein binding
• GO:0008236 serine-type peptidase activity
• GO:0016504 peptidase activator activity
• GO:0090729 toxin activity

Biological Process

• GO:0002690 positive regulation of leukocyte chemotaxis
• GO:0006508 proteolysis
• GO:0007596 blood coagulation
• GO:0010952 positive regulation of peptidase activity
• GO:0035807 induction of blood coagulation in another organism
• GO:0044469 envenomation resulting in positive regulation of blood coagulation in another organism

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0032991 protein-containing complex

External links

• PDB: RCSB:4bxw, PDBe:4bxw, PDBj:4bxw
• PDBsum: 4bxw
• PubMed: 23869089
• UniProt: Q56VR3|FAXC_PSETE Venom prothrombin activator pseutarin-C catalytic subunit