Structure of PDB 4bwb Chain B Binding Site BS01

Receptor Information

>4bwb Chain B (length=300) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SDLDVNTDIYSKVLVTAIYLALFVVGTVGNGVTLFTLARKKSRVDYYLGS
LALSDLLILLFALPVDLYNFIWVHHPWAFGDAGCKGYYFLREACTYATAL
NVVSLSVELYLAICHPAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGL
QNLSGDGTHPGGLVCTPIVDTATLRVVIQLNTFMSFLFPMLVASILNTVA
ARRLTVMVHQAAPGRVQALRRGVLVLRAVVIAFVVCWLPYHVRRLMFVYI
SDEQWTTALFDFYHYFYMLSNALVYVSAAINPILYNLVSANFRQVFLSTL

Ligand information

>4bwb Chain D (length=3) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PYI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4bwb Structure of Signaling-Competent Neurotensin Receptor 1 Obtained by Directed Evolution in Escherichia Coli
Resolution	3.57 Å
Binding residue (original residue number in PDB)	L55 F331 W339 F344 Y347
Binding residue (residue number reindexed from 1)	L3 F247 W255 F260 Y263

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004930	G protein-coupled receptor activity
GO:0016492	G protein-coupled neurotensin receptor activity

	Biological Process
GO:0007186	G protein-coupled receptor signaling pathway

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4bwb, PDBe:4bwb, PDBj:4bwb
PDBsum	4bwb
PubMed	24453215
UniProt	P20789\|NTR1_RAT Neurotensin receptor type 1 (Gene Name=Ntsr1)

[Back to BioLiP]