Structure of PDB 4bpk Chain B Binding Site BS01

Receptor Information
>4bpk Chain B (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSD
LTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDK
EMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELY
Ligand information
>4bpk Chain D (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WAREIGAKARRMADDLNAQY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bpk Structure-Guided Rational Design of Alpha/Beta-Peptide Foldamers with High Affinity for Bcl-2 Family Prosurvival Proteins.
Resolution1.756 Å
Binding residue
(original residue number in PDB)		E96 F97 Y101 L108 Q111 Q125 V126 E129 L130 N136 G138 R139 V141 F146
Binding residue
(residue number reindexed from 1)		E39 F40 Y44 L51 Q54 Q68 V69 E72 L73 N79 G81 R82 V84 F89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4bpk, PDBe:4bpk, PDBj:4bpk
PDBsum4bpk
PubMed23929624
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]