Structure of PDB 4bhm Chain B Binding Site BS01

Receptor Information
>4bhm Chain B (length=77) Species: 318829 (Pyricularia oryzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQVDAEGNPFWEISDKRRVGISQFKKMDFINIREYYEAGEMKPGKKGIGL
TVDQYTAFLKAIPAINAELRSRGHDIT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bhm Substitution of Tryptophan 89 with Tyrosine Switches the DNA Binding Mode of Pc4.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		S60 F62 M65 N69 R71 Y74 G83 T90 Q93
Binding residue
(residue number reindexed from 1)		S22 F24 M27 N31 R33 Y36 G44 T51 Q54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003713 transcription coactivator activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0060261 positive regulation of transcription initiation by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4bhm, PDBe:4bhm, PDBj:4bhm
PDBsum4bhm
PubMed25739870
UniProtG4NEJ8

[Back to BioLiP]