Structure of PDB 4bh8 Chain B Binding Site BS01

Receptor Information

>4bh8 Chain B (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGINWVKQRPGQGLEWIGY
INPGNGYTKYNEKFKGKTTLTVDKSSSTAYMQLRSLTSEDSAVYFCARSV
YYGGSYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSASMVTLGCLVKGYF
PEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCN
VAHPASSTKVDKKIVPRD

Ligand information

>4bh8 Chain P (length=8) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RPSYISHL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4bh8 Adjustable Locks and Flexible Keys: Plasticity of Epitope-Paratope Interactions in Germline Antibodies.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	S31 Y32 G33 Y50 N52 S99 V100 Y101 Y102 G103 Y106
Binding residue (residue number reindexed from 1)	S31 Y32 G33 Y50 N52 S99 V100 Y101 Y102 G103 Y106

External links

PDB	RCSB:4bh8, PDBe:4bh8, PDBj:4bh8
PDBsum	4bh8
PubMed	24790145

[Back to BioLiP]