Structure of PDB 4b6h Chain B Binding Site BS01

Receptor Information
>4b6h Chain B (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PYITSIADLTGQVALYTFCAQWEKTDIEGTLFVYRRSASPYHGFTIVNNM
NLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4b6h Structural Basis of the Pnrc2-Mediated Link between Mrna Surveillance and Decapping.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y36 F38 W45 E87 Q89 H91 F94 L96 R98 S106
Binding residue
(residue number reindexed from 1)		Y16 F18 W22 E61 Q63 H65 F68 L70 R72 S80
Enzymatic activity
Enzyme Commision number 3.6.1.62: 5'-(N(7)-methylguanosine 5'-triphospho)-[mRNA] hydrolase.
Gene Ontology
Molecular Function
GO:0008047 enzyme activator activity
Biological Process
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0043085 positive regulation of catalytic activity

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4b6h, PDBe:4b6h, PDBj:4b6h
PDBsum4b6h
PubMed23085078
UniProtQ9NPI6|DCP1A_HUMAN mRNA-decapping enzyme 1A (Gene Name=DCP1A)

[Back to BioLiP]