Structure of PDB 4b60 Chain B Binding Site BS01

Receptor Information
>4b60 Chain B (length=293) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQGDYFD
FTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDK
VDVTAELEINLFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNY
YANLNGSIETFNKANNRFSHVAFIKPNNGKTTSVTVTGTLMKGSNQNGNQ
PKVRIFEYLGNNEDIAKSVYANTTDTSKFKEVTSNMNLNLQNNGSYSLNI
ENLDKTYVVHYDGEYLNGTDVDFRTQMVGHPYTLTWDNGLVLY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4b60 Evidence for Steric Regulation of Fibrinogen Binding to Staphylococcus Aureus Fibronectin-Binding Protein a (Fnbpa).
Resolution1.83 Å
Binding residue
(original residue number in PDB)		H220 A221 G222 H254 V256 S257 F306 K338 I341 S351 I352 T491 L492 T493 W494 D495 N496 G497 L498 V499 L500 Y501
Binding residue
(residue number reindexed from 1)		H26 A27 G28 H60 V62 S63 F112 K144 I147 S157 I158 T283 L284 T285 W286 D287 N288 G289 L290 V291 L292 Y293
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005618 cell wall

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4b60, PDBe:4b60, PDBj:4b60
PDBsum4b60
PubMed24627488
UniProtP14738|FNBA_STAA8 Fibronectin-binding protein A (Gene Name=fnbA)

[Back to BioLiP]