Structure of PDB 4b20 Chain B Binding Site BS01

Receptor Information
>4b20 Chain B (length=223) Species: 2336 (Thermotoga maritima) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDYRQLHRWDLPPEEAIKVQNELRKKIKLTPYEGEPEYVAGVDLSFPGKE
EGLAVIVVLEYPSFKILEVVSERGEITFPYIPGLLAFREGPLFLKAWEKL
RTKPDVVVFDGQGLAHPRKLGIASHMGLFIEIPTIGVAKSRLYGTFKMPE
DKRCSWSYLYDGEEIIGCVIRTKEGSAPIFVSPGHLMDVESSKRLIKAFT
LPGRRIPEPTRLAHIYTQRLKKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4b20 Structural Basis of DNA Loop Recognition by Endonuclease V.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		L220 K222 G223
Binding residue
(residue number reindexed from 1)		L220 K222 G223
Binding affinityPDBbind-CN: Kd=0.11uM
Enzymatic activity
Enzyme Commision number 3.1.21.7: deoxyribonuclease V.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003727 single-stranded RNA binding
GO:0004519 endonuclease activity
GO:0016891 RNA endonuclease activity, producing 5'-phosphomonoesters
GO:0043737 deoxyribonuclease V activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4b20, PDBe:4b20, PDBj:4b20
PDBsum4b20
PubMed23313664
UniProtQ9X2H9|NFI_THEMA Endonuclease V (Gene Name=nfi)

[Back to BioLiP]