Structure of PDB 4axg Chain B Binding Site BS01

Receptor Information
>4axg Chain B (length=167) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KHPLMNVWTLWYLENMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSL
FKKNIRPMWEDAANKQGGRWVITLNKSSKTDLDNLWLDVLLCLIGEAFDH
SDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNSL
QYQLHKDTMNVKSIYTL
Ligand information
>4axg Chain D (length=15) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSYTRSRLMDIRNGM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4axg Crystal Structure of a Minimal Eif4E-Cup Complex Revelas a General Mechanism of Eif4E Regulation in Translational Repression
Resolution2.8 Å
Binding residue
(original residue number in PDB)		H70 P71 V102 W106 N110 L167 G171
Binding residue
(residue number reindexed from 1)		H2 P3 V26 W30 N34 L91 G95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000339 RNA cap binding
GO:0000340 RNA 7-methylguanosine cap binding
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0031370 eukaryotic initiation factor 4G binding
Biological Process
GO:0006412 translation
GO:0006413 translational initiation
GO:0006417 regulation of translation
GO:0016070 RNA metabolic process
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016281 eukaryotic translation initiation factor 4F complex
GO:0016604 nuclear body
GO:0031594 neuromuscular junction
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0071598 neuronal ribonucleoprotein granule
GO:0097482 muscle cell postsynaptic specialization

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4axg, PDBe:4axg, PDBj:4axg
PDBsum4axg
PubMed22832024
UniProtP48598|IF4E_DROME Eukaryotic translation initiation factor 4E1 (Gene Name=eIF4E1)

[Back to BioLiP]