Structure of PDB 4awl Chain B Binding Site BS01

Receptor Information
>4awl Chain B (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEA
SERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4awl Sequence-Specific Transcription Factor NF-Y Displays Histone-Like DNA Binding and H2B-Like Ubiquitination.
Resolution3.08 Å
Binding residue
(original residue number in PDB)		Q53 K75 I76 A77 K78
Binding residue
(residue number reindexed from 1)		Q4 K26 I27 A28 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043565 sequence-specific DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0016602 CCAAT-binding factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4awl, PDBe:4awl, PDBj:4awl
PDBsum4awl
PubMed23332751
UniProtP25208|NFYB_HUMAN Nuclear transcription factor Y subunit beta (Gene Name=NFYB)

[Back to BioLiP]